PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00569.1.p
Common NameEUGRSUZ_I00569, LOC104418343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 379aa    MW: 39731.9 Da    PI: 9.1612
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00569.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.5e-393998261
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                      +e+alkcprCds+ntkfCyynnysl+qPr+fCk+CrryWtk GalrnvP+Ggg+rknkk 
  Eucgr.I00569.1.p 39 PEQALKCPRCDSSNTKFCYYNNYSLTQPRHFCKTCRRYWTKNGALRNVPIGGGCRKNKKL 98
                      7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-273897IPR003851Zinc finger, Dof-type
PfamPF027011.3E-324197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9014397IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MTPPGTAPPK PPPMAGKEEA APSSGSRKAA SSSSSGKQPE QALKCPRCDS SNTKFCYYNN  60
YSLTQPRHFC KTCRRYWTKN GALRNVPIGG GCRKNKKLKP SSASSRLFPG GGGDPKEYYS  120
MAAAPPHPEL GGFKLFHGLA PAVDFQLGGL SNFSKAVQNH NPPAPGIYSQ FSSFSDASAI  180
ETAAAAPTSA ATCFSLDQMA GPSGTILGFN NYHALPPFIA AAPGFGTSGA LHEPGGSMKV  240
DSNLASSIES LSSINQDLHW KLQQQRLAML FSGDNNNNHN PKANNSGDVA ASSINIATAP  300
FEDQSQNLRQ PVLFQNLDAA GSSRKEGSSV TEWFFGNAYA SVTTPSPTNS SSNGNDNNNA  360
GNWNSKGPGQ GFQYTALP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00569.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0990434e-49AC099043.6 Oryza sativa chromosome 3 BAC OSJNBa0079B15 genomic sequence, complete sequence.
GenBankAK0633804e-49AK063380.1 Oryza sativa Japonica Group cDNA clone:001-114-F11, full insert sequence.
GenBankAM0843634e-49AM084363.1 Hordeum vulgare subsp. vulgare partial dof15 gene for dof zinc finger protein 15.
GenBankAP0047914e-49AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149594e-49AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAP0149624e-49AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126114e-49CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027969.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A059AKU60.0A0A059AKU6_EUCGR; Uncharacterized protein
STRINGVIT_00s0218g00040.t011e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-42Dof family protein